.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b5m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Conserved Uncharacterized Protein from Rhodopirellula baltica. To be Published
    Site NYSGXRC
    PDB Id 3b5m Target Id NYSGXRC-10069h
    Molecular Characteristics
    Source Rhodopirellula baltica
    Alias Ids TPS7946,Q7UTD8, PF04289 Molecular Weight 21328.38 Da.
    Residues 195 Isoelectric Point 6.17
    Sequence mileslvttldeqgrinlaplgpivlppqspgglpqfllrpyegsttcdnllasgnavihviddallia ktaigkvdasdlvvpipgledthvrlkrchrwfavrvtqragtpprheltarclasglvdpffgfnrak havieaavaatrlhllppeeieeelerariaiektggeperealqlirrhvressis
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.21 Rfree 0.20237
    Matthews' coefficent 2.34 Rfactor 0.17636
    Waters 1341 Solvent Content 47.49

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 3b5m

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch