The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Mn(II)-bound glyoxalase from Novosphingobium aromaticivorans. To be Published
    Site NYSGXRC
    PDB Id 3b59 Target Id NYSGXRC-11004z
    Molecular Characteristics
    Source Novosphingobium aromaticivorans
    Alias Ids TPS7861,PF00903, Q2GAG3_NOVAD, Molecular Weight 32940.44 Da.
    Residues 300 Isoelectric Point 5.55
    Sequence msrvteiryvgygvkdfdaekafyadvwglepvgedannawfkaqgadehhvvqlrradenridviala adsrsdvdalrasveaagckvasepavlatpgggygfrffspdgllfevssdvakgakrdlarwegvpv kishivlhspnhqdmvkfftdvlgfkvsdwlgdfmcflrcnsahhriailpgppclnhvaydmlsvddm mrgahrlkvkgidigwgpgrhtagnntfsyfvtpggfvteytseleevdfdthqykvhvpapmvmdqwg igtggpqtlphphanpglfqtaea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.53 Rfree 0.257
    Matthews' coefficent 2.98 Rfactor 0.218
    Waters 232 Solvent Content 58.76

    Ligand Information
    Metals MN (MANGANESE) x 6


    Google Scholar output for 3b59

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch