.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zay

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of response regulator from Desulfuromonas acetoxidans. To be Published
    Site NYSGXRC
    PDB Id 2zay Target Id NYSGXRC-11006u
    Molecular Characteristics
    Source Desulfuromonas acetoxidans
    Alias Ids TPS7863,Q1JZD9_DESAC, 3.40.50.2300, PF00072 Molecular Weight 31893.54 Da.
    Residues 287 Isoelectric Point 8.84
    Sequence makrkkfgevlvdegvidenilqralsqqagtgkrlgqileeqqviserdialvlarqfglktvkniad hnfpdkildlvdsekalqklifplkveektlylamvnpldmetldtlsfgtglrivpyltttqeihaai nrhymksiqvpaegkwwrimlvdtqlpalaasisalsqegfdiiqcgnaieavpvavkthphliitean mpkisgmdlfnslkknpqtasipvialsgratakeeaqlldmgfidfiakpvnairlsarikrvlklly edlsapparrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.261
    Matthews' coefficent 1.92 Rfactor 0.225
    Waters 57 Solvent Content 35.95

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2zay

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch