.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rgy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural analysis of transcription regulator of LacI family from Burkholderia phymatum. To be Published
    Site NYSGXRC
    PDB Id 2rgy Target Id NYSGXRC-11011j
    Molecular Characteristics
    Source Burkholderia phymatum
    Alias Ids TPS7873,3.40.50.2300, PF00532, A0FW12_9BURK Molecular Weight 38894.83 Da.
    Residues 360 Isoelectric Point 5.78
    Sequence myrcstrragrvserqaqtlqadgdtvatlkdvaelagvglstasraisgkgpvsadaaarvkaaiael nfrpssigramatqqlgiiglfvptffgsyygtilkqtdlelravhrhvvvatgcgestpreqaleavr fligrdcdgvvvishdlhdedldelhrmhpkmvflnrafdalpdasfcpdhrrggelaaatliehghrk lavisgpftasdnverldgffdelarhgiardsvpliesdfspeggyaatcqlleskapftglfcandt mavsalarfqqlgisvpgdvsvigydddysaayaapaltsvhiptaeltqnavrwlinqcygtkweifr efpvtvsmrasvarv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.267
    Matthews' coefficent 2.33 Rfactor 0.21
    Waters 174 Solvent Content 47.11

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2rgy

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch