.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rbb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase family enzyme from Burkholderia phytofirmans PsJN. To be Published
    Site NYSGXRC
    PDB Id 2rbb Target Id NYSGXRC-11003k
    Molecular Characteristics
    Source Burkholderia phymatum
    Alias Ids TPS7859,PF00903, 3.10.180.10, A0GG76_9BURK Molecular Weight 18198.83 Da.
    Residues 161 Isoelectric Point 4.98
    Sequence mfvtilivqhaqnrfnviapvaqsegqseeknmadlsyvniftrdivalsafyqqvfgfqeiesirspi frgldtgkscigfnaheayellqlaqfsetsgikfllnfdvdtkeavdklvpvaiaagatlikapyety yhwyqavlldpernvfrinnvll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.82 Rfree 0.259
    Matthews' coefficent 2.64 Rfactor 0.239
    Waters 227 Solvent Content 53.41

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2rbb

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch