.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r0b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of protein phosphatases. J.Struct.Funct.Genom. 8 121-140 2007
    Site NYSGXRC
    PDB Id 2r0b Target Id NYSGXRC-8698a
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS7914,PF00782, NP_660294 Molecular Weight 25491.11 Da.
    Residues 223 Isoelectric Point 5.89
    Sequence medvklefpslpqckedaeewtypmrremqeilpglflgpyssamksklpvlqkhgithiicirqniea nfikpnfqqlfrylvldiadnpveniirffpmtkefidgslqmggkvlvhgnagisrsaafviayimet fgmkyrdafayvqerrfcinpnagfvhqlqeyeaiylakltiqmmsplqierslsvhsgttgslkrthe eeddfgtmqvataqng
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.283
    Matthews' coefficent 2.28 Rfactor 0.260
    Waters 114 Solvent Content 45.96

    Ligand Information
    Ligands SO4 (SULFATE) x 2;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2r0b
    1. Structural genomics of protein phosphatases
    SC Almo, JB Bonanno, JM Sauder, S Emtage - Journal of structural and , 2007 - Springer
     
    2. Overproduction, purification and structure determination of human dual-specificity phosphatase 14
    GT Lountos, JE Tropea, S Cherry - Section D: Biological , 2009 - scripts.iucr.org
     
    3. Automatch: Target_binding protein design and enzyme design by automatic pinpointing potential active sites in available protein scaffolds
    C Zhang, L Lai - Proteins: Structure, Function, and , 2011 - Wiley Online Library
     

    Protein Summary



    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch