The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Mandelate Racemase/Muconate Lactonizing Enzyme from Roseovarius nubinhibens ISM. To be Published
    Site NYSGXRC
    PDB Id 2qye Target Id NYSGXRC-9436d
    Molecular Characteristics
    Source Roseovarius nubinhibens
    Alias Ids TPS7839,ZP_00960427.1, PF01188 Molecular Weight 40392.59 Da.
    Residues 369 Isoelectric Point 5.71
    Sequence mritrirlyktdlpyvdgsygwgagnaitvarasvvvidtdaglqgcgeftpcgenymiahsegvdafa rlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatgqpvwmllggklcdgapmyrv apqrseaetraelarhraagyrqfqikvgadwqsdidriraclpllepgekamadanqgwrvdnairla ratrdldyileqpcrsyeecqqvrrvadqpmkldecvtglhmaqrivadrgaeicclkisnlgglskar rtrdflidnrmpvvaedswggeiasaavahfaastpeeflinstdlmnyntrstglggptvhqgrlyas dtpglgvtpdfnslgapvadwalp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.00 Rfree 0.25611
    Matthews' coefficent 2.41 Rfactor 0.1937
    Waters 1025 Solvent Content 48.91

    Ligand Information
    Ligands GOL (GLYCEROL) x 7
    Metals MG (MAGNESIUM) x 8


    Google Scholar output for 2qye

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch