.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qy6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the N-terminal domain of UPF0209 protein yfcK from Escherichia coli O157:H7. To be Published
    Site NYSGXRC
    PDB Id 2qy6 Target Id NYSGXRC-10095a
    Molecular Characteristics
    Source Escherichia coli o157:h7
    Alias Ids TPS7960,Q8XCQ7, PF05430 Molecular Weight 76777.13 Da.
    Residues 688 Isoelectric Point 6.08
    Sequence lrslthiakielppvrrvtyvkhysiqpanlefnaegtpvsrdfddvyfsndngleetryvflggnqle arfpehphplfvvaesgfgtglnfltlwqafdqfreahpqaqlqrlhfisfekfpltradlalahqhwp elapwaeqlqaqwpmplpgchrllldegrvtldlwfgdinelisqlddslnqkvdawfldgfapaknpd mwtqnlfnamarlarpggtlatftsagfvrrglqeagftmqkrkgfgrkremlcgvmeqtlplpcstpw fnrtgsskrevaiigggiasallslallrrgwqvtlycadeapalgasgnrqgalypllskhdealnrf fsngftfarrlydslpvkfdhdwcgvtqlgwdeksqhkiaqmlsmdlpeelavaveanaveqitgvttn csgitypqggwlcpaeltrnvlelaqqqglqiyyqyqlqdlsrkddcwlltfagdqqathsvvvlangh qisrfsqtsslpvysvagqvshipttpelaklkqvlcydgyltpqnpanqhhcigasyhrgseetayse dnqqqnrqrlidcfphaqwaktvdvskkearcgvrcatrdhlpmvgnvpdyeatlveyaslaeqkdkav sapvfddlfmfaalgsrglcsaplcaeilaaqmsdepipmdastlaalnpnrlwvrkllkgkavkag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.268
    Matthews' coefficent 2.88 Rfactor 0.225
    Waters 215 Solvent Content 57.32

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qy6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch