.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qxy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a response regulator from Thermotoga maritima. To be Published
    Site NYSGXRC
    PDB Id 2qxy Target Id NYSGXRC-11013u
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS7877,3.40.50.2300, Q9WZU6_THEMA, PF00072 Molecular Weight 29645.77 Da.
    Residues 253 Isoelectric Point 8.35
    Sequence vtptvmvvdesritflavknalekdgfnviwakneqeaftflrrekidlvfvdvfegeeslnlirrire efpdtkvavlsayvdkdliinsvkagavdyilkpfrldyllervkkiisstprvtvslrkniedleitl kfedivrkeikrsnrtgsrfcvmyvkfedimrdyetikkffretdyvlpisaseylfvltltgkhgiea vtrrmkeklserfsytyvcypddgktyeeiiltlkdrmakprgnes
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.240
    Matthews' coefficent 2.19 Rfactor 0.219
    Waters 182 Solvent Content 43.73

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2qxy

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch