.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qv0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the response regulatory domain of protein mrkE from Klebsiella pneumoniae. To be Published
    Site NYSGXRC
    PDB Id 2qv0 Target Id NYSGXRC-11030g
    Molecular Characteristics
    Source Klebsiella pneumoniae
    Alias Ids TPS7892,3.40.50.2300, MRKE_KLEPN, PF00072 Molecular Weight 30288.15 Da.
    Residues 269 Isoelectric Point 5.25
    Sequence mpgnkigllnvhhrvkllygeglhirnltpgteiafyvpnnstpqgdgvavvmsgekmkviivedefla qqelswlinthsqmeivgsfddgldvlkflqhnkvdaifldinipsldgvllaqnisqfahkpfivfit awkehaveafeleafdyilkpyqesriinmlqklttaweqqnnaasglasaaprendtinlikderiiv tsihdiyyaeahekmtfvytrresfvmpmnitefvpdalniaasgqskflltvaqvsianrf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.282
    Matthews' coefficent 2.60 Rfactor 0.220
    Waters 11 Solvent Content 52.64

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qv0
    1. Conformational dynamics in the Acyl-CoA synthetases, adenylation domains of non-ribosomal peptide synthetases, and firefly luciferase
    AM Gulick - ACS chemical biology, 2009 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch