.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qsr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of C-terminal domain of transcription-repair coupling factor. To be Published
    Site NYSGXRC
    PDB Id 2qsr Target Id NYSGXRC-10118d
    Molecular Characteristics
    Source Streptococcus pneumoniae
    Alias Ids TPS7973,Q8DRQ1, PF03461 Molecular Weight 134794.66 Da.
    Residues 1169 Isoelectric Point 5.45
    Sequence mvtlldlfsendqikkwhqnltdkkrqlilglststkalaiasslekedrivlltstygeaeglvsdli silgeelvypflvddapmveflmssqekiisrvealrfltdsskkgilvcniaasrlilpspnafkdsi vkisvgeeydqhafihqlkengyrkvtqvqtqgefslrgdildifeisqlepcrieffgdeidgirsfe vetqlskenkteltifpasdmllrekdyqrgqsalekqisktlspilksyleeilssfhqkqshadsrk flslcydktwtvfdyiekdtpiffddyqklmnqyevferelaqyfteelqnskafsdmqyfsdieqiyk kqspvtffsnlqkglgnlkfdkiyqfnqypmqeffnqfsflkeeierykkmdytiilqssnsmgsktle dmleeyqikldsrdktsickesvnliegnlrhgfhfvdekilliteheifqkklkrrfrrqhvsnaerl kdynelekgdyvvhhihgigqylgietieikeihrdyvsvqyqngdqisipveqihllskyissdgkap klnklndghfkkakqkvknqvediaddliklysersqlkgfafsaddddqdafddafpyvetddqlrsi eeikrdmqasqpmdrllvgdvgfgktevamraafkavndhkqvvilvpttvlaqqhytnfkerfqnfav nvdvlsrfrskkeqtatleklkngqvdiligthrvlskdvvfadlglmiideeqrfgvkhketlkelkk qvdvltltatpiprtlhmsmlgirdlsvietpptnrypvqtyvlekndsvirdavlremerggqgyyly nkvdtivqkvselqelipeasigyvhgrmsevqlentlldfiegqydilvtttiietgvdipnantlfi enadhmglstlyqlrgrvgrsnriayaylmyrpeksisevsekrleaikgftelgsgfkiamrdlsirg agnllgksqsgfidsvgfelysqlleeaiakrngnanantrtkgnaelilqidaylpdtyisdqrhkie iykkirqidnrvnyeelqeelidrfgeypdvvaylleiglvksyldkvfvqrverkdnkitiqfekvtq rlflaqdyfkalsvtnlkagiaenkglmelvfdvqnkkdyeilegllifgeslleikeskeknsi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.10 Rfree 0.243
    Matthews' coefficent 3.09 Rfactor 0.184
    Waters Solvent Content 60.25

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qsr

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch