.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qs8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Xaa-Pro dipeptidase with bound methionine in the active site. To be Published
    Site NYSGXRC
    PDB Id 2qs8 Target Id NYSGXRC-9355e
    Molecular Characteristics
    Source Unknown
    Alias Ids TPS7824,PF01979 Molecular Weight 44134.83 Da.
    Residues 408 Isoelectric Point 5.37
    Sequence mdvdsktlihagklidgksdqvqsrisividgniisdikkgfissndfedyidlrdhtvlpglmdmhvh fgqeyqskaqapikveremqailatqhayvtfksgfttvrqvgdsglvaislrdainsgklagprifaa gktiattgghadptngkavddydypvpeqgvvngpyevyaavrqrykdgadgikitvtggvlsvaksgq npqftqeevdavvsaakdygmwvavhahgaegmkraikagvdsiehgtfmdleamdlmiengtyyvpti sagefvaekskidnffpeivrpkaasvgpqisdtfrkayekgvkiafgtdagvqkhgtnwkefvymven gmpamkaiqsatmetakllriedklgsiesgkladliavkgnpiedisvlenvdvvikdglly
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.33 Rfree 0.234
    Matthews' coefficent 2.88 Rfactor 0.207
    Waters 285 Solvent Content 57.28

    Ligand Information
    Ligands MET x 2
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2qs8
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    2. Characterization of the phenylurea hydrolases A and B: founding members of a novel amidohydrolase subgroup
    J Khurana, C Jackson, C Scott, G Pandey, I Horne - Biochem. J, 2009 - biochemj.org
     
    3. Functional annotation of two new carboxypeptidases from the amidohydrolase superfamily of enzymes
    DF Xiang, C Xu, D Kumaran, AC Brown, JM Sauder - Biochemistry, 2009 - ACS Publications
     
    4. Functional identification and structure determination of two novel prolidases from cog1228 in the amidohydrolase superfamily
    DF Xiang, Y Patskovsky, C Xu, AA Fedorov - Biochemistry, 2010 - ACS Publications
     
    5. Studies on the inference of protein binding regions across fold space based on structural similarities
    J Teyra, J Hawkins, H Zhu - : Structure, Function, and , 2011 - Wiley Online Library
     
    6. Molinate hydrolase from Gulosibacter molinativorax ON4T-a novel cobalt dependent amidohydrolase
    M Duarte, F Ferreira-da-Silva, H Lnsdorf - Journal of , 2011 - Am Soc Microbiol
     
    7. ENZYMES AND METHODS FOR HYDROLYSING PHENYLUREAS, CARBAMATES AND ORGANOPHOSPHATES
    JL Khurana, CJ Jackson, C Scott - US Patent , 2011 - freepatentsonline.com
     

    Protein Summary

    Despite the Genbank annotation of this protein as an Xaa-Pro dipeptidase, Frank Raushel and coworkers have identified this protein and related family members as a Xaa-Phe dipeptidase. The protein tolerates several different hydrophobic residues at the C-terminus of the peptide substrate. The structure has methionine bound in the active site.
     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch