The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the N-terminal signal receiver domain of two-component system response regulator from Bacteroides fragilis. To be Published
    Site NYSGXRC
    PDB Id 2qr3 Target Id NYSGXRC-11018p
    Molecular Characteristics
    Source Bacteroides fragilis
    Alias Ids TPS7882,, Q64UD2_BACFR, PF00072 Molecular Weight 49358.05 Da.
    Residues 443 Isoelectric Point 6.54
    Sequence mgtiiivddnkgvltavqlllknhfskvitlsspvslstvlreenpevvlldmnftsginngneglfwl heikrqyrdlpvvlftayadidlavrgikegasdfvvkpwdnqklletllnaasqakdgkkknrkkess pvsamywgessamqqlrtliekvattnanilitgengtgkemlareihalsprsaesmisvdmgaites lfeselfghvkgsftdahadrtgkfeaadrsslfldeignlpfhlqaklltaiqqrsivrvgsnqsipv dirlicatnrnlqemvdkglfredllyrintihveipplrkrkedivplaerfiarfckqydkasisls paacekltahawygnirelehsiekaviisdgetipaemfqlvqktenpetetstledmekamirkald kcggnlsavaaqlgitrqtlynkmkkfgl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.234
    Matthews' coefficent 2.13 Rfactor 0.202
    Waters 30 Solvent Content 42.31

    Ligand Information


    Google Scholar output for 2qr3

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch