The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of mandelate racemase/muconate lactonizing enzyme-like protein from Rubrobacter xylanophilus DSM 9941. To be Published
    Site NYSGXRC
    PDB Id 2qq6 Target Id NYSGXRC-9367a
    Molecular Characteristics
    Source Rubrobacter xylanophilus
    Alias Ids TPS7828,PF02746 Molecular Weight 43930.34 Da.
    Residues 400 Isoelectric Point 5.08
    Sequence msapritrvetaairavgpsvlvrvwagdehglgecypsapaagihhivmnmeeqllgedprdverlye kmrrwniftggqagavitalsgietalwdlagklqgvpvyrllggafrrrvrlyadcnagtvdaaahhi egglfeegsneeyiavareavergfdaikldvdditgplhrdfwngaispreheamvarvaavreavgp evevaidmhgrfdipssirfaramepfgllwleeptppenldalaevrrststpicagenvytrfdfre lfakravdyvmpdvakcgglaeakrianlaeldyipfaphnvsspvgtvaaahvcaavsnfavlewhai dmphwedfvrypggpvireghielteepglgleldeeaafehrhekggvpffgrt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.90 Rfree 0.2823
    Matthews' coefficent 2.75 Rfactor 0.2218
    Waters 28 Solvent Content 55.27

    Ligand Information
    Metals MG (MAGNESIUM) x 2


    Google Scholar output for 2qq6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch