.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qde

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of mandelate racemase/muconate lactonizing enzyme family protein from Azoarcus sp. EbN1. To be Published
    Site NYSGXRC
    PDB Id 2qde Target Id NYSGXRC-9379a
    Molecular Characteristics
    Source Azoarcus sp.
    Alias Ids TPS7831,PF02746 Molecular Weight 41819.95 Da.
    Residues 387 Isoelectric Point 5.49
    Sequence mkitkvevipistpmkraqlmrgatlaridgvllklhsdeglvgiadagdtsswyrgetqdsitsmicd ffapkvllgedptkiekivgrmdiltrdnnqakatvdfalhdlvgkrfgvpvyqllggktieriplglv lgagepeavaeealavlregfhfvklkaggplkadiamvaevrravgddvdlfidingawtydqaltti ralekynlskieqplpawdldgmarlrgkvatpiyadesaqelhdllaiinkgaadglmiktqkaggll kaqrwltlarlanlpvicgcmvgsgleaspaahllaandwiaqfpqenagplhihdclnsrdidndial nvprfeggylypndgpglgielnedlvrrlvtpgkaarvvta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 1.93 Rfree 0.225
    Matthews' coefficent 2.84 Rfactor 0.197
    Waters 1619 Solvent Content 56.61

    Ligand Information
    Ligands
    Metals BA (BARIUM) x 8

    Jmol

     
    Google Scholar output for 2qde
    1. SABER: A computational method for identifying active sites for new reactions
    GR Nosrati, KN Houk - Protein Science, 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch