The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of NtrC family transcriptional regulator from Clostridium acetobutylicum. To be Published
    Site NYSGXRC
    PDB Id 2q5c Target Id NYSGXRC-10108c
    Molecular Characteristics
    Source Clostridium acetobutylicum
    Alias Ids TPS7966,Q97LU5, PF06506 Molecular Weight 71078.45 Da.
    Residues 627 Isoelectric Point 9.04
    Sequence mslkialisqnenllnlfpklaleknfipitktasltraskiafglqdevdaiisrgatsdyikksvsi psisikvtrfdtmravynakrfgnelaliaykhsivdkheieamlgvkikeflfssedeittliskvkt enikivvsgktvtdeaikqglygetinsgeeslrraieealnlievrnielrrsarfkaildaigegii vtdqfkkiitynnsinkiftktgskllgksiqsvipnykvdsilknvepetkiiknfngliiaakqfpv kledkiigvvntfedvtkiqtlekiirkkihekgfvakynfddiltqdknmielkklallysktdssil iqgesgsgkelfaqsihnssprkngpfvaincaalpehlleselfgyeggsftgakkegkqglfelahn gtifldeigelskplqaqllrvleekeimhiggdkiipvdiriisstnrnllnsiengtfredlyyrln vfnltlpplrergkdieilaehflenthnfssnrskilnqitpflmaynwpgntrelsnvmerislfie nsmtinwsqvlykvvhkekiedtltlkvpynltmkeiieltekrvihsllerydndhnrvaeilnigrttlwrkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.49 Rfree 0.210
    Matthews' coefficent 2.56 Rfactor 0.187
    Waters 389 Solvent Content 51.95

    Ligand Information
    Ligands SO4 (SULFATE) x 11;GOL (GLYCEROL) x 4


    Google Scholar output for 2q5c

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch