The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative formate dehydrogenase accessory protein from Desulfotalea psychrophila. To be Published
    Site NYSGXRC
    PDB Id 2pw9 Target Id NYSGXRC-10038i
    Molecular Characteristics
    Source Desulfotalea psychrophila
    Alias Ids TPS7939,Q6AMB9, PF02634 Molecular Weight 28103.87 Da.
    Residues 258 Isoelectric Point 6.32
    Sequence mskldiplsimqksvvirpggrqemdehvaietpyaialndrvigssmvlpvdleefgagflfgqgyik kaeeireilvcpqgrisvyadveneepreviitsgcggtgkipkemlegefapladyclpfaeiksfir ealhssplgpqthcvhgcglwnngrlqvyhedvgrhnavdkvlgsillgrasnnsavyttgrltsdmvl kcarigipiimsrtspsslglalakrsgatlvaysrperinvfnaperilt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.259
    Matthews' coefficent 2.18 Rfactor 0.196
    Waters 304 Solvent Content 43.63

    Ligand Information
    Ligands SO4 (SULFATE) x 2


    Google Scholar output for 2pw9

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch