.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ps2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative mandelate racemase/muconate lactonizing enzyme from Aspergillus oryzae. To be Published
    Site NYSGXRC
    PDB Id 2ps2 Target Id NYSGXRC-9440a
    Molecular Characteristics
    Source Aspergillus oryzae
    Alias Ids TPS7842,BAE64617, PF01188 Molecular Weight 40217.64 Da.
    Residues 371 Isoelectric Point 5.33
    Sequence msdlkiaridvfqvdlpysggvyylsagreyrsfdativrittdtgiegwgestpfgsnyiashprgvr agiatmapsligldprrvdrindamddallghedaktaidvacwdifgksvglpvcellggrtntrlpl issiyvgepedmrarvakyrakgykgqsvkisgepvtdakritaalanqqpdeffivdangklsvetal rllrllphgldfaleapcatwrecislrrktdipiiydelatnemsivkiladdaaegidlkiskaggl trgrrqrdiclaagysvsvqetcgsdiafaaivhlaqtiperslrcilecrdmvtvktadgafdiqdgf atapttpglgimprldvlgeavasyf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.209
    Matthews' coefficent 2.31 Rfactor 0.194
    Waters 790 Solvent Content 46.72

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 4

    Jmol

     
    Google Scholar output for 2ps2
    1. Using Catalytic Atom Maps to Predict the Catalytic Functions Present in Enzyme Active Sites
    GR Nosrati, KN Houk - Biochemistry, 2012 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch