.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ppg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative isomerase from Sinorhizobium meliloti. To be Published
    Site NYSGXRC
    PDB Id 2ppg Target Id NYSGXRC-9279b
    Molecular Characteristics
    Source Sinorhizobium meliloti
    Alias Ids TPS7805,PF02746 Molecular Weight 42447.37 Da.
    Residues 389 Isoelectric Point 6.37
    Sequence msdrvkkiesftltlpretpylgkprpgeepngrgylvrkanrtvyptfdrsvlvrietengavgwget yglvapratmeiiddlladftigrdpfdaaaihddlydlmrvrgytggfyvdalaaidialwdlagkla glpvckllggqrrdriaayisglpedtrakraelaaawqakgfssfkfaspvaddgvakemeilrerlg pavriacdmhwahtaseavalikamephglwfaeapvrtedidglarvaasvstaiavgeewrtvhdmv prvarralaivqpemghkgitqfmrigayahvhhikviphatigagiflaaslqasaalanvdchefqh sifepnrrllvgdmdclngeyvvptgpglgvepskeaqgllkkh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.49 Rfree 0.252
    Matthews' coefficent 2.06 Rfactor 0.183
    Waters 134 Solvent Content 40.42

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ppg
    1. The LabelHash algorithm for substructure matching
    M Moll, DH Bryant, LE Kavraki - BMC bioinformatics, 2010 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch