.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pof

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of CDP-diacylglycerol pyrophosphatase. To be Published
    Site NYSGXRC
    PDB Id 2pof Target Id NYSGXRC-10285a
    Molecular Characteristics
    Source Escherichia coli o157:h7
    Alias Ids TPS8013,Q8X7A5, PF02611 Molecular Weight 28381.10 Da.
    Residues 251 Isoelectric Point 7.01
    Sequence mkkagllflvmiviavvaagigywkltgeesdtlrkivleeclpnqqqnqnpspcaevkpnagyvvlkd lngplqyllmptyringtesplltdpstpnffwlawqardfmskkygqpvpdravslainsrtgrtqnh fhihiscirpdvreqldnnlanissrwlplpgglrgheylarrvteselvqrspfmmlaeevpearehm gsyglamvrqsdnsfvllatqrnlltlnrasaeeiqdhqceilr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.40 Rfree 0.257
    Matthews' coefficent 1.89 Rfactor 0.249
    Waters 304 Solvent Content 34.82

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pof

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch