.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pod

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Member of Enolase Superfamily from Burkholderia Pseudomallei. To be Published
    Site NYSGXRC
    PDB Id 2pod Target Id NYSGXRC-9253e
    Molecular Characteristics
    Source Burkholderia pseudomallei
    Alias Ids TPS7786,PF02746 Molecular Weight 44513.05 Da.
    Residues 400 Isoelectric Point 5.22
    Sequence mkiteietlrpeefpnllwvlvhtdegitglgetfygacsaeayihewaanrligedplqidrhakrls gylgfrsagaemrgnsaldialwdifgkatgqpiyqllggkcrdtirtyntcagphyvrtakqqsvanw glansvsaryddlnaflhradelaldlldsgitamkiwpfdpyaeasdgyyisksdlkralepfekirr avgdkmdvmvefhslwnlppalqiaealreyetfwhedpirmdslsslkryaerslapvcasetlatrw gfrdlletnaagivmldiswcgglsearkiasmaeawhlpvaphdctgpvvltasthlslnapnalvqe svrafydgwyrdlvtalptvkdghitvpdgpglglelmpdirerltiavrntsdc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.34 Rfree 0.27451
    Matthews' coefficent 2.45 Rfactor 0.20937
    Waters 152 Solvent Content 53.00

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 2

    Jmol

     
    Google Scholar output for 2pod
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch