.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pmr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a protein of unknown function from Methanobacterium thermoautotrophicum. To be Published
    Site NYSGXRC
    PDB Id 2pmr Target Id NYSGXRC-10200d
    Molecular Characteristics
    Source Methanobacterium thermoautotrophicum
    Alias Ids TPS7998,O27725, PF04010 Molecular Weight 9091.92 Da.
    Residues 77 Isoelectric Point 4.92
    Sequence mdcreriekdlelleknlmemksiklsddeeavveralnyrddsvyylekgdhitsfgcityahgllds lrmlhrii
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.32 Rfree 0.19130
    Matthews' coefficent 1.99 Rfactor 0.17459
    Waters 66 Solvent Content 38.11

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pmr
    1. Molecular replacement using ab initio polyalanine models generated with ROSETTA
    DJ Rigden, RM Keegan, MD Winn - Acta Crystallographica Section D , 2008 - scripts.iucr.org
     
    2. EDM-DEDM and protein crystal structure solution
    R Caliandro, B Carrozzini, GL Cascarano - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch