.
The Open Protein Structure Annotation Network
PDB Keyword
.

2plg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of T110839 protein from Synechococcus elongatus. To be Published
    Site NYSGXRC
    PDB Id 2plg Target Id NYSGXRC-10450c
    Molecular Characteristics
    Source Synechococcus elongatus
    Alias Ids TPS8049,Q8DKM0_SYNEL, BIG_38 Molecular Weight 16688.04 Da.
    Residues 153 Isoelectric Point 4.30
    Sequence mtmvsevqpvspasldaplenaveiietvisslhqgdaplvgqtdsgkiwmfrygsaevfvqlsghtee dfltiwspvlplpvadelalyrklltlnwlttfeahfaiaeeqvqvvasrtlggitageisrlitivat laddyddalraefkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.237
    Matthews' coefficent 4.83 Rfactor 0.216
    Waters 106 Solvent Content 74.51

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2plg

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch