.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pju

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of propionate catabolism operon regulatory protein prpR. To be Published
    Site NYSGXRC
    PDB Id 2pju Target Id NYSGXRC-10108a
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS7965,P77743, PF06506 Molecular Weight 58646.14 Da.
    Residues 528 Isoelectric Point 8.29
    Sequence mahpprlnddkpviwtvsvtrlfelfrdislefdhlanitpiqlgfekavtyirkklanercdaiiaag sngaylksrlsvpvilikpsgydvlqalakagkltssigvvtyqetipalvafqktfnlrldqrsyite edargqinelkangteavvgaglitdlaeeagmtgifiysaatvrqafsdaldmtrmslrhnthdatrn alrtryvlgdmlgqspqmeqvrqtillyarssaavliegetgtgkelaaqaihreyfarhdarqgkksh pfvavncgaiaeslleaelfgyeegaftgsrrggraglfeiahggtlfldeigemplplqtrllrvlee kevtrvgghqpvpvdvrvisathcnleedmqqgrfrrdlfyrlsilrlqlpplrervadilplaesflk vslaalsapfsaalrqglqasetvllhydwpgnirelrnmmerlalflsveptpdltpqfmqlllpela resaktpaprlltpqqalekfngdktaaanylgisrttfwrrlks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.252
    Matthews' coefficent 2.14 Rfactor 0.201
    Waters 272 Solvent Content 42.61

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pju

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch