.
The Open Protein Structure Annotation Network
PDB Keyword
.

2php

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the C-terminal domain of protein MJ0236 (Y236_METJA). To be Published
    Site NYSGXRC
    PDB Id 2php Target Id NYSGXRC-10417a
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS8039,Y236_METJA, BIG_769 Molecular Weight 47492.05 Da.
    Residues 421 Isoelectric Point 8.79
    Sequence lvilmvilaiggydptsgagisadiktahtlgvycptittsvipqnnkmvyekfdlpeeniknqfkavf eefdieyvktgvltkpaidtllkyidkydlkvicdpvlasttkfsfvdeklmekyielfnksflitpnk eeykkimefiknnnlmirndlyilatgiddilmknfkpiktfkgfrvdkevhgtgcvystaitaflskg ydleeaikeakrfvlssviyakkskfgynsnptyinkekviknlsyaiyllkkmnftlipevgsniaes lpfpkdfkdvaaltgriiknklggfyivgdiefgasehiakiilsaskfnpeiracmnikydgglikll kdkfavssfdrkeeppnvstmewgtkiacekfggvpdiiydrggegkepmirvlgrdaievvkkveviq kiyntlm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.03 Rfree 0.2380
    Matthews' coefficent 2.99 Rfactor 0.2162
    Waters 330 Solvent Content 58.90

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 9

    Jmol

     
    Google Scholar output for 2php
    1. Bicyclic guanidinium oligomers for recognition, cell delivery, and molecular materials
    J Valero Moreno - 2011 - tdx.cat
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch