.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pgw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative muconate cycloisomerase from Sinorhizobium meliloti 1021. To be Published
    Site NYSGXRC
    PDB Id 2pgw Target Id NYSGXRC-9387a
    Molecular Characteristics
    Source Sinorhizobium meliloti
    Alias Ids TPS7835,PF02746 Molecular Weight 40996.80 Da.
    Residues 374 Isoelectric Point 5.69
    Sequence mvkisnvrvrplvlplkqpyhwsygiresfavnlieieaddgtvgigectvapdqtgtaailyrlakhl vghsphdvapliarifhqeylghganimraanqifsgidmamwdlqgklaglpvhqllggahrkavgyf yflqgetaeelardaavghaqgervfylkvgrgekldleitaavrgeigdarlrldanegwsvhdainm crklekydiefieqptvswsipamahvrekvgipivadqaaftlydvyeicrqraadmicigpreiggi qpmmkaaavaeaaglkicihssfttgittcaehhiglaipnlddgnqimwqlvqedivsspdltpkngw ldafrkpglgfqlaedlvaegegryaasr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 1.95 Rfree 0.215
    Matthews' coefficent 2.46 Rfactor 0.196
    Waters 1679 Solvent Content 49.95

    Ligand Information
    Ligands GOL (GLYCEROL) x 6
    Metals

    Jmol

     
    Google Scholar output for 2pgw
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    2. VASP-S: A Volumetric Analysis and Statistical Model for Predicting Steric Influences on Protein-Ligand Binding Specificity
    BY Chen, S Bandyopadhyay - Bioinformatics and Biomedicine ( , 2011 - ieeexplore.ieee.org
     
    3. A statistical model of overlapping volume in ligand binding cavities
    BY Chen, S Bandyopadhyay - Bioinformatics and Biomedicine , 2011 - ieeexplore.ieee.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch