.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p84

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the hypothetical protein from Staphylococcus phage 37. To be Published
    Site NYSGXRC
    PDB Id 2p84 Target Id NYSGXRC-10427g
    Molecular Characteristics
    Source Caudovirales
    Alias Ids TPS8044,BIG_182, Q4ZC86_9CAUD Molecular Weight 16058.94 Da.
    Residues 135 Isoelectric Point 4.31
    Sequence mipkfrefdrerhrtdyqkgmsyaeqqdfdmgftiwfdhiedldliekdgtinrivmmstglkdknvke iyesdivrnlygelyvvewldgsfvltefynggydhyiidssteyevlgniyenpelleddnhasn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.273
    Matthews' coefficent 2.44 Rfactor 0.208
    Waters 102 Solvent Content 45.01

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p84

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch