.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p76

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Glycerophosphodiester Phosphodiesterase from Staphylococcus aureus. To be Published
    Site NYSGXRC
    PDB Id 2p76 Target Id NYSGXRC-6255a
    Related PDB Ids 2oog 
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS7755,PF03009, NP_371483.1 Molecular Weight 35309.08 Da.
    Residues 309 Isoelectric Point 8.67
    Sequence mtnssksftkfmaasavftmgflsvptagaeqtnqiankpqaiqwhtnltnerfttiahrgasgyapeh tfqaydkshnelkasyieidlqrtkdghlvamhdetvnrttnghgkvedytldelkqldagswfnkkyp kyarasyknakvptldeilerygpnanyyietkspdvypgmeeqllaslkkhhllnnnklknghvmiqs fsdeslkkihrqnkhvplvklvdkgelqqfndqrlkeirsyaiglgpdytdlteqnthhlkdlgfivhp ytvnekadmlrlnkygvdgvftnfadkykevik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.60 Rfree 0.265
    Matthews' coefficent 3.24 Rfactor 0.249
    Waters 34 Solvent Content 62.05

    Ligand Information
    Ligands GOL (GLYCEROL) x 8
    Metals NA (SODIUM) x 8

    Jmol

     
    Google Scholar output for 2p76

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch