The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of LAO/AO transport system kinase. To be Published
    Site NYSGXRC
    PDB Id 2p67 Target Id NYSGXRC-10158a
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS7981,PF03308, P27254 Molecular Weight 36701.94 Da.
    Residues 331 Isoelectric Point 6.10
    Sequence mineatlaesirrlrqgeratlaqamtlvesrhprhqalstqlldaimpycgntlrlgvtgtpgagkst fleafgmllireglkvaviavdpsspvtggsilgdktrmndlaraeaafirpvpssghlggasqrarel mllceaagydvvivetvgvgqsetevarmvdcfislqiagggddlqgikkglmevadlivinkddgdnh tnvaiarhmyesalhilrrkydewqprvltcsalekrgideiwhaiidfktaltasgrlqqvrqqqsve wlrkqteeevlnhlfanedfdryyrqtllavknntlsprtglrqlsefiqtqyfd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.23
    Matthews' coefficent 2.84 Rfactor 0.207
    Waters 212 Solvent Content 56.70

    Ligand Information
    Metals CL (CHLORIDE) x 4;NA (SODIUM) x 1


    Google Scholar output for 2p67

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch