.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p0l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Lipoate-protein ligase A. To be Published
    Site NYSGXRC
    PDB Id 2p0l Target Id NYSGXRC-10425h
    Molecular Characteristics
    Source Streptococcus agalactiae
    Alias Ids TPS8042,BIG_791, Q3D8N4_STRAG, PF03099 Molecular Weight 31609.80 Da.
    Residues 278 Isoelectric Point 4.88
    Sequence lewqdlaqlpvsifkdyvtdaqdaekpfiwtevflreinrsnqeiilhiwpmtktvilgmldrelphle lakkeiisrgyepvvrnfgglavvadegilnfslvipdvferklsisdgylimvdfirsifsdfyqpie hfevetsycpgkfdlsingkkfaglaqrrikngiavsiylsvcgdqkgrsqmisdfykiglgdtgspia ypnvdpeimanlsdlldcpmtvedvidrmlislkqvgfndrllmirpdlvaefdrfqaksmankgmvsrde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.04 Rfree 0.273
    Matthews' coefficent 2.10 Rfactor 0.231
    Waters 79 Solvent Content 41.42

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p0l

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch