.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oy9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an unknown conserved protein - Pfam: UPF0223. To be Published
    Site NYSGXRC
    PDB Id 2oy9 Target Id NYSGXRC-10286b
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS8014,Q9K9K7, PF05256 Molecular Weight 10516.37 Da.
    Residues 88 Isoelectric Point 4.89
    Sequence mkttlpisldwsteevidvvhffqaieqaydqgiaredllgkyrrfkeivpskseekqlfrayeqendv scyqtikkareemeehiqm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.223
    Matthews' coefficent 2.40 Rfactor 0.209
    Waters 133 Solvent Content 48.84

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2oy9
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Bacterial toxin-antitoxin systems
    J Guglielmini, L Van Melderen - 2012 - landes.bjmu.edu.cn
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch