.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ox7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the hypothetical protein from Enterococcus faecalis. To be Published
    Site NYSGXRC
    PDB Id 2ox7 Target Id NYSGXRC-10427a
    Molecular Characteristics
    Source Enterococcus faecalis
    Alias Ids TPS8043,BIG_182, Q835D7_ENTFA Molecular Weight 16853.10 Da.
    Residues 145 Isoelectric Point 4.45
    Sequence mipkfrawdtyekemlenvtplfddsnsmiaiitdfqikgspgtseieigsydttfnwdefpyvimqst glkdkngveifegdilvydapkkyahrrsmheiayadgrffwefldlvfcqsnilyrdgylvignihen pellegn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.78 Rfree 0.23531
    Matthews' coefficent 2.34 Rfactor 0.18973
    Waters 663 Solvent Content 47.36

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ox7

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch