.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oo3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the hypothetical lpl1258 protein from Legionella pneumophila. To be Published
    Site NYSGXRC
    PDB Id 2oo3 Target Id NYSGXRC-10044e
    Molecular Characteristics
    Source Legionella pneumophila
    Alias Ids TPS7940,PF04378, Q5WX40 Molecular Weight 32831.12 Da.
    Residues 282 Isoelectric Point 8.78
    Sequence mlsyqhgyhagnfadvikhitltrllaylthkdkplfylethsgrgiydlkdkqslkteeykeginpvw ldrenlpslfleyisvikqinlnstlryypgspyfainqlrsqdrlylcelhpteynfllklphfnkki yvnhtdgvsklnallpppekrglifidpsyerkeeykeipyaiknayskfstglycvwypvvnkawteq flrkmreissksvrielhlnplinegmtgcglwiinppytfpseikavletlttyfnpgsssymiesgs klchgl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.21
    Matthews' coefficent 1.99 Rfactor 0.164
    Waters 163 Solvent Content 38.05

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 2oo3
    1. Nucleic acid constructs encoding cytotoxic ribonuclease variants
    RT Raines, JC Mitchell, TJ Rutkoski - US Patent 7,977,079, 2011 - Google Patents
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch