.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o8r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Polyphosphate Kinase from Porphyromonas Gingivalis. To be Published
    Site NYSGXRC
    PDB Id 2o8r Target Id NYSGXRC-6342d
    Molecular Characteristics
    Source Porphyromonas gingivalis
    Alias Ids TPS7759,YP_001929928.1 Molecular Weight 80651.14 Da.
    Residues 695 Isoelectric Point 6.66
    Sequence vdvsaypffrrdmswlsfnervlmeaadrtlpvydrikflsifssnleefytvrvayhqavlqkrrdrs eaeedsdadahilqairetvirqdelyyrifydqilptleehgirlrthapthpdhkaylrrffheeif pllypmlllpskvrtfirsgrvylavrlkeketdeaysyallnvptdglprfvelprlqtdtfyyysfl ediikehldvvfpgyevmdsysikvsrdadllldaqrpedlpgeirkkvktrklgaptrfmydgrmpde vlryicsscdidpeeairsgnyvnlqdlamlpnpfaprletltpepllskhleqapslmegirrkdyli hvpyytydyvvrllmeaaispdvseirltqyrvaenssiisaleaaaqsgkkvsvfvelkarfdeennl rlsermrrsgirivysmpglkvhaktalilyhtpagerpqgiallstgnfnettariysdttlmtantd ivhdvyrlfrildgdpeparfsrllvarynmgeaitnliereienvkrgkrgymllkmnglqdknvitq lyraseagveidlivrgicclvpdmpqsrnirvtrlvdmylehsriwcfhnggkeevfissadwmkrnl ynrietacpvldpalrreiidileiqlrdnikacridsslnniykhnsdekpvraqaaiyrylkgkeeatpaak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.25457
    Matthews' coefficent 2.91 Rfactor 0.1879
    Waters 56 Solvent Content 57.80

    Ligand Information
    Ligands SO4 (SULFATE) x 13
    Metals

    Jmol

     
    Google Scholar output for 2o8r

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch