.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o56

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative Enolase from Salmonella Typhimurium Lt2. To be Published
    Site NYSGXRC
    PDB Id 2o56 Target Id NYSGXRC-9270b
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS7800,16767118, PF01188 Molecular Weight 43655.92 Da.
    Residues 397 Isoelectric Point 5.22
    Sequence mmkitsvdiidvandfasatskwrpvvvkintdegisgfgevglaygvgasagigmakdlsaiiigmdp mnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplykmlggksrekirtyasqlqfg wgdgsdkdmltepeqyaqaaltavsegydaikvdtvamdrhgnwnqqnlngpltdkilrlgydrmaair davgpdvdiiaemhaftdttsaiqfgrmieelgifyyeepvmplnpaqmkqvadkvniplaageriywr wgyrpflengslsviqpdictcggitevkkicdmahvydktvqihvcggpistavalhmetaipnfvih elhryallepntqtckynylpkngmyevpelpgigqelteetmkksptitvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.00 Rfree 0.25531
    Matthews' coefficent 2.58 Rfactor 0.20887
    Waters 1808 Solvent Content 52.30

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 8

    Jmol

     
    Google Scholar output for 2o56
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch