.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o3j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Caenorhabditis Elegans Udp-Glucose Dehydrogenase. To be Published
    Site NYSGXRC
    PDB Id 2o3j Target Id NYSGXRC-9442a
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS7843,PF00984, NP_505730 Molecular Weight 52752.37 Da.
    Residues 481 Isoelectric Point 5.92
    Sequence mtdqvfgkvskvvcvgagyvggptcamiahkcphitvtvvdmntakiaewnsdklpiyepgldeivfaa rgrnlffssdipkaiaeadlifisvntptkmygrgkgmapdlkyvesvsrtiaqyaggpkivvekstvp vkaaesigcilreaqknnenlkfqvlsnpeflaegtamkdlanpdrvliggesspeglqavaelvriye nwvprnriittntwsselsklvanaflaqrissinsisavceatgaeisevahavgydtrigskflqas vgfggscfqkdvlslvylceslnlpqvadywqgvininnwqrrrfadkiiaelfntvtdkkiaifgfaf kkntgdtressaihvikhlmeehaklsvydpkvqksqmlndlasvtsaqdverlitvesdpyaaargah aivvltewdefvelnysqihndmqhpaaifdgrlildqkalreigfrtfaigtspdqaynlfgtagy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.88 Rfree 0.26315
    Matthews' coefficent 2.80 Rfactor 0.20858
    Waters 844 Solvent Content 56.14

    Ligand Information
    Ligands GOL (GLYCEROL) x 9
    Metals

    Jmol

     
    Google Scholar output for 2o3j
    1. Activation of Bacillus subtilis Ugd by the BY-Kinase PtkA Proceeds via Phosphorylation of Its Residue Tyrosine 70
    D Petranovic, C Grangeasse, B Macek - Journal of Molecular , 2009 - content.karger.com
     
    2. UDP-glucose dehydrogenase: structure and function of a potential drug target
    S Egger, A Chaikuad, KL Kavanagh - Biochemical , 2010 - www-06.all-portland.net
     
    3. Structure and mechanism of human UDP-glucose 6-dehydrogenase
    S Egger, A Chaikuad, KL Kavanagh - Journal of Biological , 2011 - ASBMB
     
    4. Structure of Burkholderia cepacia UDP-glucose dehydrogenase (UGD) BceC and role of Tyr10 in final hydrolysis of UGD thioester intermediate
    J Rocha, AO Popescu, P Borges - Journal of , 2011 - Am Soc Microbiol
     
    5. Conformational change upon product binding to Klebsiella pneumoniae UDP-glucose dehydrogenase: A possible inhibition mechanism for the key enzyme in
    YY Chen, TP Ko, CH Lin, WH Chen - Journal of structural biology, 2011 - Elsevier
     
    6. Cloning, expression, purification, crystallization and preliminary crystallographic studies of BceC, a UDP-glucose dehydrogenase from Burkholderia cepacia IST408
    J Rocha, AO Popescu, I Sa-Correia - Section F: Structural , 2010 - scripts.iucr.org
     
    7. Structure of a UDP-glucose dehydrogenase from the hyperthermophilic archaeon Pyrobaculum islandicum
    H Sakuraba, T Kawai, K Yoneda - Section F: Structural , 2012 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch