.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o16

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative acetoin utilization protein (AcuB) from Vibrio cholerae. To be Published
    Site NYSGXRC
    PDB Id 2o16 Target Id NYSGXRC-3506h
    Molecular Characteristics
    Source Vibrio cholerae
    Alias Ids TPS7747,NP_230386.1 Molecular Weight 18571.23 Da.
    Residues 168 Isoelectric Point 5.09
    Sequence gkgvrdpgsdgslrrkelamikvedmmtrhphtllrthtlndakhlmealdirhvpivdankkllgivs qrdllaaqesslqrsaqgdslafetplfevmhtdvtsvapqaglkesaiymqkhkigclpvvakdvlvg iitdsdfvtiainllelqeesepdeldeeq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.234
    Matthews' coefficent 2.03 Rfactor 0.174
    Waters 225 Solvent Content 39.49

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 7
    Metals

    Jmol

     
    Google Scholar output for 2o16
    1. Crystal structure of ST2348, a CBS domain protein, from hyperthermophilic archaeon Sulfolobus tokodaii
    P Ragunathan, T Kumarevel, Y Agari, A Shinkai - Biochemical and , 2008 - Elsevier
     
    2. Peptidoglycan biosynthesis machinery: A rich source of drug targets
    A Gautam, R Vyas, R Tewari - Critical Reviews in , 2011 - ingentaconnect.com
     
    3. Using correlated parameters for improved ranking of proteinprotein docking decoys
    P Mitra, D Pal - Journal of computational chemistry, 2011 - Wiley Online Library
     
    4. THE STruCTurAL BASiS For iNorGANiC PyroPHoSPHATASE CATALySiS AND rEGuLATioN
    H Tuominen - 2011 - doria.fi
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch