.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nx2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein ypsA from Bacillus subtilis. To be Published
    Site NYSGXRC
    PDB Id 2nx2 Target Id NYSGXRC-10273a
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS8010,PF06908, P50838 Molecular Weight 21057.83 Da.
    Residues 180 Isoelectric Point 4.67
    Sequence mkvlaitgykpfelgifkqddkalyyikkaiknrliafldeglewilisgqlgvelwaaeaaydlqeey pdlkvavitpfyeqeknwkepnkeqyeavlaqadyeaslthrpyesplqfkqknqffidksdgllllyd pekegspkymlgtaekrreqdgypiyfitmddlrvtveedsy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.224
    Matthews' coefficent 2.13 Rfactor 0.18
    Waters 143 Solvent Content 42.20

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2nx2

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch