.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ns9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein APE2225 from Aeropyrum pernix K1. To be Published
    Site NYSGXRC
    PDB Id 2ns9 Target Id NYSGXRC-10024b
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS7936,PF06240, Q9Y9R3 Molecular Weight 16885.25 Da.
    Residues 156 Isoelectric Point 9.09
    Sequence mrlhagvwglkvryegsfevsktpeevfefltdpkrfsrafpgfksvevedgsftielrlslgplrgda rvrasfedlekpskatvkgsgrgagstldftlrfavepsgggsrvswvfegnvgglaasmggrvldsla rrmindvisgvkrelgea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.27752
    Matthews' coefficent 1.98 Rfactor 0.21667
    Waters 169 Solvent Content 38.01

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2ns9
    1. The Bet v 1 fold: an ancient, versatile scaffold for binding of large, hydrophobic ligands
    C Radauer, P Lackner - BMC evolutionary biology, 2008 - biomedcentral.com
     
    2. A new approach to assess and predict the functional roles of proteins across all known structures
    ES Julfayev, RJ McLaughlin, YP Tao - Journal of structural and , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch