.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nlz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of cephalosporin acylase from Bacillus halodurans. To be Published
    Site NYSGXRC
    PDB Id 2nlz Target Id NYSGXRC-6166d
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS7750,PF01019, NP_241733.1 Molecular Weight 58876.58 Da.
    Residues 539 Isoelectric Point 5.64
    Sequence vsvmfdpqsypypsrrnvvyakngmvatsqplaaqagldilkaggnaidaaiatataltvleptsngig sdafalvwtkgklhglngsgrapmsltmeavkakgyeqelppygvipvtvpgapgawaelakmygnlpl aaslapairyaeegypvtptlakywkaaydrfktewtddvyqpwfdtfapkgraprvgevwrsqghadt lrsiaesngesfyrgeladqihaffdkhggyltkedlacyrpewvepisidyrgyrvweippngqglva lealnivkgfefyhkdtvdtyhkqieamklafvdgmkyvtepsdmsvsveqllsdeyaterrkeigeqa ltpepgtpprggtvylatadgdgnmvsfiqsnymgfgsgvvvpgtgiamqnrghnfsldpnhdnalkpg krtyhtiipgfltkndqpigpfgvmggfmqpqghmqvmmntidfglnpqaaldaprwqwtngkqvqvep tfpvdiaqalvrrghkiqvvldegafgrgqiiwrdpttgvlaggteprtdgqvaaw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.70 Rfree 0.24458
    Matthews' coefficent 2.63 Rfactor 0.20982
    Waters 281 Solvent Content 53.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2nlz
    1. Gamma_glutamyl transferase in the cell wall participates in extracellular glutathione salvage from the root apoplast
    M Ferretti, T Destro, SCE Tosatto, N La Rocca - New , 2009 - Wiley Online Library
     
    2. Biochemical and structural properties of gamma-glutamyl transpeptidase from Geobacillus thermodenitrificans: An enzyme specialized in hydrolase activity
    I Castellano, A Merlino, M Rossi, F La Cara - Biochimie, 2010 - Elsevier
     
    3. Gene cloning and protein expression of _-glutamyltranspeptidases from Thermus thermophilus and Deinococcus radiodurans: comparison of molecular and structural
    I Castellano, A Di Salle, A Merlino, M Rossi, F La Cara - Extremophiles, 2011 - Springer
     
    4. _-Glutamyltranspeptidases: sequence, structure, biochemical properties, and biotechnological applications
    I Castellano, A Merlino - Cellular and Molecular Life Sciences, 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch