.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kuc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of a putative disulphide-isomerase from Bacteroides thetaiotaomicron. To be Published
    Site NYSGXRC
    PDB Id 2kuc Target Id NYSGXRC-11211c
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS33380,AAO78175.1, 3.40.30.10, PF00085 Molecular Weight 46992.59 Da.
    Residues 416 Isoelectric Point 6.35
    Sequence mkrhfwafmaivcllavqntqgqqmvpaqkisatpaagaqmtlaqadgiafrelsfpealkraevedkl lfvdcfttwcgpckrlskvvfkdslvadyfnrhfvnlkmdmekgegvelrkkygvhayptllfinssge vvyrlvgaedapellkkvklgvesgglsglkkryeagdrdlaficgyinalsaanreqeagkvaadflq gseqkmlededyflvfyyyvhdvnssafqyavnhkkeitdkfprqaasldrrlledwiagsyaylkvde snhctfdeqgldayvakmkqmnvaeadmigeslrlsrdgimkqwdsfvkrgdkilashtilgdeghllq wvnwlnkecadmslrekaaqwcdkaceelikkneeikknlppgaipaismvdhkgqllqvaeklrklmqqs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kuc

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch