.
The Open Protein Structure Annotation Network
PDB Keyword
.

2im5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Nicotinate phosphoribosyltransferase from Porphyromonas gingivalis. To be Published
    Site NYSGXRC
    PDB Id 2im5 Target Id NYSGXRC-6211b
    Molecular Characteristics
    Source Porphyromonas gingivalis
    Alias Ids TPS7752,NP_904408.1, PF04095 Molecular Weight 45466.72 Da.
    Residues 394 Isoelectric Point 6.10
    Sequence mgiirsildtdlykfttgyayaklfpraygefrfidrnrqgfteefaelvrgeiramaalsltrdekef lqrelpylppiyidfldgfrfdpeevtvsidaqghldiraqgllyrvtlwetpilaviselyyrfigae pdwkqveevtrskgelmrehratfsifgmrrrfslevedrvtdilkqyageslfgtsnvhlahkhglrv sgthphewiqfhgaiygykmanyvamedwinvydgdlgtvltdtyttdvfmrnfskkhamlftslrhds gdpeifiekavrryeelrvdpkikyiifsdsltpqraieiqklcagrikasfgigtnltndvgggvepl nivmklwkckmtakddwhycvklsdvdgkhtgepeeillamntlgikpk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.241
    Matthews' coefficent 2.36 Rfactor 0.22
    Waters 363 Solvent Content 47.80

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2im5

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch