.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ics

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an adenine deaminase. TO BE PUBLISHED
    Site NYSGXRC
    PDB Id 2ics Target Id NYSGXRC-9295a
    Molecular Characteristics
    Source Enterococcus faecalis
    Alias Ids TPS7812,29375425, PF01979 Molecular Weight 40656.18 Da.
    Residues 369 Isoelectric Point 5.10
    Sequence mdydllikngqtvngmpveiaikekkiaavaatisgsaketihlepgtyvsagwiddhvhcfekmalyy dypdeigvkkgvttvidagttgaenihefydlaqqaktnvfglvniskwgivaqdeladlskvqaslvk kaiqelpdfvvgikarmsrtvigdngitplelakqiqqenqeiplmvhigsapphldeilalmekgdvl thcfngkengildqatdkikdfawqaynkgvvfdighgtdsfnfhvaetalregmkaasistdiyirnr engpvydlattmeklrvvgydwpeiiekvtkapaenfhltqkgtleigkdadltiftiqaeektltdsn gltrvakeqirpiktiiggqiydn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.239
    Matthews' coefficent 2.48 Rfactor 0.198
    Waters 108 Solvent Content 50.30

    Ligand Information
    Ligands ADE (ADENINE) x 1
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2ics
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    2. Structure of dihydropyrimidinase from Sinorhizobium meliloti CECT4114: New features in an amidohydrolase family member
    S Martnez-Rodrguez, AI Martnez-Gmez - Journal of structural , 2010 - Elsevier
     
    3. Aminohydrolases acting on adenine, adenosine and their derivatives
    H Pospisilova, I Frebort - BIOMEDICAL PAPERS-PALACKY , 2007 - biomed.papers.upol.cz
     
    4. Catalytic mechanism and three-dimensional structure of adenine deaminase
    SS Kamat, A Bagaria, D Kumaran - Biochemistry, 2011 - ACS Publications
     
    5. Reversible post-translational carboxylation modulates the enzymatic activity of N-acetyl-L-ornithine transcarbamylase
    Y Li, X Yu, J Ho, D Fushman, N Allewell - Biochemistry, 2010 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch