.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i52

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of hypothetical protein PTO0218 from Picrophilus torridus. To be Published
    Site NYSGXRC
    PDB Id 2i52 Target Id NYSGXRC-10163d
    Molecular Characteristics
    Source Picrophilus torridus
    Alias Ids TPS7985,Q6L2J9, PF04038 Molecular Weight 13690.86 Da.
    Residues 120 Isoelectric Point 5.12
    Sequence mydpaekyfnctdiqraffeagiklgaifhqytgipvnsenasmaeefierstmiqpfvenvrisinnv krssgtysysslnekmlhaevlinyngkkvlgvlnydegldypvmyakevl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.08 Rfree 0.225
    Matthews' coefficent 2.56 Rfactor 0.176
    Waters 605 Solvent Content 51.88

    Ligand Information
    Ligands GOL (GLYCEROL) x 4
    Metals CA (CALCIUM) x 12;CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 2i52
    1. Comparative genomics guided discovery of two missing archaeal enzyme families involved in the biosynthesis of the pterin moiety of methanopterin and
    V De Crecy-Lagard, G Phillips - ACS Chemical , 2012 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch