The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative malic enzyme (malate oxidoreductase). To be Published
    Site NYSGXRC
    PDB Id 2hae Target Id NYSGXRC-T1736
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS8228,15643308 Molecular Weight 42250.35 Da.
    Residues 386 Isoelectric Point 5.65
    Sequence msldaleihrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwntvavvsdgs avlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivkslepsfgginledigapkc frilqrlseemnipvfhddqqgtavvvsaaflnalkltekkieevkvvvngigaagynivkflldlgvk nvvavdrkgilnendpetclneyhleiaritnperlsgdletalegadffigvsrgnilkpewikkmsr kpvifalanpvpeidpelareagafivatgrsdhpnqvnnllafpgimkgavekrskitknmllsavea iarscepeperiipeafdmkvhlnvytavkgsaeghhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 3.13 Rfree 0.2819
    Matthews' coefficent 2.89 Rfactor 0.2421
    Waters 183 Solvent Content 57.38

    Ligand Information
    Metals ZN (ZINC) x 1


    Google Scholar output for 2hae

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch