.
The Open Protein Structure Annotation Network
PDB Keyword
.

2guw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of AMP Nucleosidase from Salmonella typhimurium LT2. To be Published
    Site NYSGXRC
    PDB Id 2guw Target Id NYSGXRC-6176c
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS8251,16420540, 16765341 Molecular Weight 54001.03 Da.
    Residues 484 Isoelectric Point 5.65
    Sequence menkgtnltpeqaldrleelyeqsvnalreaiadyvdngtlpdpharlnglfvypslsvswdgatpnpp ktrafgrfthpgcytttvtrpalfraylleqlnlvyhdygahiaveashheipypyvidgsaltldrsm sagltrhfpttelaqigdetadglfhpgefyplshfdarrvdfslarlrhytgtpvehfqpfvlftnyt ryvdefvrwgcsqildpdspyialscaggiwitaeteapeeaisdlawkkhqmpawhlvtadgqgitlv nigvgpsnakticdhlavlrpdvwlmighcgglresqaigdyvlahaylrddhvldavlppdipipsia evqralydatkavsgmpgeevkqrlrtgtvvttddrnwelrysasalrfnlsravaidmesatiaaqgy rfrvpygtllcvsdkplhgeiklpgqanrfyegaisehlqigiraidllraegdrlhsrklrtfneppfr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.64 Rfree 0.282
    Matthews' coefficent 3.12 Rfactor 0.244
    Waters 29 Solvent Content 60.56

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2guw

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch