.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gge

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Mandelate Racemase/Muconate Lactonizing Enzyme from Bacillus Subtilis complexed with MG++ at 1.8 A. To be Published
    Site NYSGXRC
    PDB Id 2gge Target Id NYSGXRC-9293a
    Related PDB Ids 2gdq 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS7811,16078161, PF01188 Molecular Weight 42017.90 Da.
    Residues 371 Isoelectric Point 7.71
    Sequence vkivrietfplfhrlekpygdangfkryrtcyliriitesgidgwgecvdwlpalhvgftkriipfllg kqagsrlslvrtiqkwhqraasavsmalteiaakaadcsvcelwggryreeipvyasfqsysdspqwis rsvsnveaqlkkgfeqikvkiggtsfkedvrhinalqhtagssitmildanqsydaaaafkweryfsew tnigwleeplpfdqpqdyamlrsrlsvpvaggenmkgpaqyvpllsqrcldiiqpdvmhvngidefrdc lqlaryfgvrasahaydgslsrlyalfaqaclppwskmkndhiepiewdvmenpftdlvslqpskgmvh ipkgkgigteinmeivnrykwdgsay
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 1.89 Rfree 0.253
    Matthews' coefficent 2.23 Rfactor 0.189
    Waters 1710 Solvent Content 44.80

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 8;CL (CHLORIDE) x 3

    Jmol

     
    Google Scholar output for 2gge
    1. Approximate Search on Protein Structures for Identification of Horizontal Gene Transfer in Bacteria
    S Billa, MA Griep, PZ Revesz - Ninth Symposium of Abstraction, , 2011 - aaai.org
     
    2. Protein StructureBased Method for Identification of Horizontal Gene Transfer in Bacteria
    S Billa - 2011 - digitalcommons.unl.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch