.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g59

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of protein phosphatases. J.Struct.Funct.Genom. 8 121-140 2007
    Site NYSGXRC
    PDB Id 2g59 Target Id NYSGXRC-8635a
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS7909,PF00102, NP_109592 Molecular Weight 138336.77 Da.
    Residues 1216 Isoelectric Point 5.68
    Sequence mghlptgihgarrllpllwlfvlfknatafhvtvqddnnivvsleasdvispasvyvvkitgesknyff efeefnstlpppvifkasyhglyyiitlvvvngnvvtkpsrsitvltkplpvtsvsiydykpspetgvl feihypekynvftrvnisywegkdfrtmlykdffkgktvfnhwlpgmcysnitfqlvseatfnkstlve ysgvshepkqhrtapyppqnisvrivnlnknnweeqsgnfpeesfmrsqdtigkeklfhfteetpeips gnissgwpdfnssdyettsqpywwdsasaapesedefvsvlpmeyennstlsetekstsgsfsffpvqm iltwlppkpptafdgfhihiereenfteylmvdeeahefvaelkepgkyklsvttfsssgscetrksqs akslsfyispsgewieeltekpqhvsvhvlssttalmswtssqenynstivsvvsltcqkqkesqrlek qyctqvnsskpiienlvpgaqyqvviylrkgpligppsdpvtfaivptgikdlmlyplgptavvlswtr pylgvfrkyvvemfyfnpatmtsewttyyeiaatvsltasvrianllpawyynfrvtmvtwgdpelscc dsstisfitapvapeitsveyfnsllyiswtygddttdlshsrmlhwmvvaegkkkikksvtrnvmtai lslppgdiynlsvtactergsntsmlrlvklepappkslfavnktqtsvtllwveegvadffevfcqqv gssqktklqepvavsshvvtissllpatayncsvtsfshdspsvptfiavstmvtemnpnvvvisvlai lstlliglllvtliilrkkhlqmarecgagtfvnfaslerdgklpynwrrsifafltllpsclwtdyll afyinpwsknglkkrkltnpvqlddfdayikdmakdsdykfslqfeelkligldiphfaadlplnrckn rytnilpydfsrvrlvsmneeegadyinanyipgynspqeyiatqgplpetrndfwkmvlqqksqiivm ltqcnekrrvkcdhywpfteepiaygditvemiseeeqddwacrhfrinyademqdvmhfnytawpdhg vptanaaesilqfvhmvrqqatkskgpmiihcsagvgrtgtfialdrllqhirdhefvdilglvsemrs yrmsmvqteeqyifihqcvqlmwmkkkqqfcisdviyenvsks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.19 Rfree 0.237
    Matthews' coefficent 2.37 Rfactor 0.199
    Waters 269 Solvent Content 48.18

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2g59
    1. Large-scale structural analysis of the classical human protein tyrosine phosphatome
    AJ Barr, E Ugochukwu, WH Lee, ONF King - Cell, 2009 - Elsevier
     
    2. Structural genomics of protein phosphatases
    SC Almo, JB Bonanno, JM Sauder, S Emtage - Journal of structural and , 2007 - Springer
     
    3. The Trypanosoma brucei Life Cycle Switch TbPTP1 Is Structurally Conserved and Dephosphorylates the Nucleolar Protein NOPP44/46
    S Chou, BC Jensen, M Parsons, T Alber - Journal of Biological , 2010 - ASBMB
     
    4. Avirulence proteins AvrBs7 from Xanthomonas gardneri and AvrBs1. 1 from Xanthomonas euvesicatoria contribute to a novel gene-for-gene interaction in pepper
    N Potnis, GV Minsavage, JK Smith - Molecular Plant- , 2011 - Am Phytopath Society
     

    Protein Summary



    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch