.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eui

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a probable acetyltransferase. To be Published
    Site NYSGXRC
    PDB Id 2eui Target Id NYSGXRC-T1065
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS8154,Q9HX01 Molecular Weight 18047.76 Da.
    Residues 153 Isoelectric Point 6.44
    Sequence mrivqatlehldllaplfvkyrefygmlsypessrkflekrlrrkesviylaladeedrllgfcqlyps fsslslkrvwilndiyvaeearrqlvadhllqhakqmarethavrmrvstsvdnevaqkvyesigfred qefknytlpisdels
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.80 Rfree 0.283
    Matthews' coefficent 3.03 Rfactor 0.227
    Waters 137 Solvent Content 59.41

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2eui

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch