The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target. Proc.Natl.Acad.Sci.Usa 103 2063-2068 2006
    Site NYSGXRC
    PDB Id 2b58 Target Id NYSGXRC-9502a
    Related PDB Ids 2b3u 2b5g 2b4d 2b3v 2b4b 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS7851,NP_00296, PF00583 Molecular Weight 20022.95 Da.
    Residues 171 Isoelectric Point 5.09
    Sequence makfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpkehwtpegh sivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrcssmhflvaewnepsin fykrrgasdlsseegwrlfkidkeyllkmatee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.253
    Matthews' coefficent 2.30 Rfactor 0.204
    Waters 82 Solvent Content 46.41

    Ligand Information
    Ligands COA (COENZYME) x 1


    Google Scholar output for 2b58
    1. Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
    MC Bewley, V Graziano, J Jiang - Proceedings of the , 2006 - National Acad Sciences
    2. Mechanistic and structural analysis of human spermidine/spermine N 1-acetyltransferase
    SS Hegde, J Chandler, MW Vetting, M Yu - Biochemistry, 2007 - ACS Publications

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch